PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0071600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 641aa    MW: 73838.5 Da    PI: 8.3171
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0071600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.11.7e-1273120148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+WT  E  +l +++k++G ++Wk++ +  g+ R++k+c++ w ++l
  ORGLA01G0071600.1  73 KGPWTSLENSILEKYIKKHGERNWKLVQKNTGLLRCGKSCRLXWINHL 120
                        79******************************99**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.01768124IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-1771123IPR009057Homeodomain-like
SMARTSM007174.7E-1072122IPR001005SANT/Myb domain
PfamPF002492.1E-1073120IPR001005SANT/Myb domain
SuperFamilySSF466897.99E-1974150IPR009057Homeodomain-like
CDDcd001671.09E-775120No hitNo description
PROSITE profilePS500906.226121158IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.6E-12124154IPR009057Homeodomain-like
SMARTSM007173.7125169IPR001005SANT/Myb domain
PROSITE profilePS500903.903371422IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.0E-5406423IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
RSLRRATARV EALAACAVIA HASAGMVACG CTGAAAILIL TGQHWYMSNS DDESFVDKDK  60
DCRRGTVAPL LKKGPWTSLE NSILEKYIKK HGERNWKLVQ KNTGLLRCGK SCRLXWINHL  120
RPNLKKGAFS KEEKNKIINL HRKIGNKWSR MAADISSPCS SLFFLLLSEY ISLETVYKSV  180
VLXXFLHHKY VWXPLHGGEV RGILIFVVHP LVKLFNLKLV SFFFPIALQV CFATFTWRYG  240
YYXYLXFNCW XSYFLXLNEC YPFHLFQLIF GSFCITSLSX NMIIITNQIN PNKHMXILSK  300
SHPXNYLRNV AYFCLYXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  360
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXPGRT DNEIKNYWNT  420
RIKKCKNNRW LLYPANVCND ALNEDQYGSV DPSVREKLTN NQLEDTTSMY SAPQFSYASI  480
SNILDRRLAS KDYDSIEDQR NRIEIAAEYE ISLPVLKTTN NDIFPSASIF ANHGISNGNL  540
SALSTTDALQ MELPLIQFDP NNQFIYSRDY AMHLTNLALL NDQSEELLNH IDVLNYVVMK  600
EELSGGSLSP TINMPCEATA YSLELPLCKG YREQDLDFYT Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-1669152385B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0029000.0AP002900.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0443E07.
GenBankAP0034340.0AP003434.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0452F10.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639103.11e-131PREDICTED: transcription factor GAMYB
TrEMBLI1NLH60.0I1NLH6_ORYGL; Uncharacterized protein
STRINGORGLA01G0071600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP154081018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.18e-36myb domain protein 33